SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013769 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013769
Domain Number 1 Region: 18-273
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 6.67e-57
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013769   Gene: ENSAMEG00000013084   Transcript: ENSAMET00000014343
Sequence length 275
Comment pep:novel scaffold:ailMel1:GL194488.1:28925:37090:1 gene:ENSAMEG00000013084 transcript:ENSAMET00000014343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEVPENGSPSCPKDGTRFKHLRKYVYNYEAESSTGVAGDSFSRSATRINCKVELDVPQL
CSFILRTSQCTLKEGYSFNPNGRPSLHKSKNSEEFAAAMSKYELRLAIPEGKQVSLYPDK
EEPKHILNIKRGIISALLVPPETEEDKQVVFLDTVYGNCSSDLTVETKKANVATRISIER
DLENCDHFKPISTGVSPLALIKGMLHPFSTLISSNQSCQYTLDPKNKHVSEAICKEQHVL
LPFSTKDKHAMMAKVTQTLKLEDTPKINSRFFDEG
Download sequence
Identical sequences G1M358
ENSAMEP00000013769 ENSAMEP00000013769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]