SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013820 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013820
Domain Number 1 Region: 126-231
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000041
Family Fibronectin type III 0.0078
Further Details:      
 
Domain Number 2 Region: 324-508
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000169
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013820   Gene: ENSAMEG00000013118   Transcript: ENSAMET00000014396
Sequence length 655
Comment pep:known_by_projection scaffold:ailMel1:GL192799.1:1060075:1075655:1 gene:ENSAMEG00000013118 transcript:ENSAMET00000014396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGAPSAPPQAPGPRLKLVLLPLLVLLCHRTRSQGSPGPLQCYGVGPLGDLNCSWEAVGD
LGDPSMLHLQSQKYHSNRTWTVPVPTGQSWVTIPREQLTMSDELLVWGTKAGQPLWPPVF
VNLETRMKPGAPQLYPDVDFSEDEPLEATIHWAPPVWPPHKVLVCQFYYRRCQETTWTPL
EPEVRSRPLSPVEIQDLELATGYEVHGRCRMEKEKNLWSERSPVLSFQTLPSAPKDVWVS
RNLCGTPGRQEPLLLWKDRGRCMQMSYRVWFQAEDQELVQKTVPCCSSFIPTQAEWVGVS
AVNATSWEPLTNLSLACLGPDFAPHGVAVSNVAGSTELLVTWQRGPGELQEHVVDWARDG
DPLEDLNWIRLPPENLSALLPGNFEGGVPYRITVTAVSSWGLAPAPSVWRFREELAPLAG
PVLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCVQSGTRPSVCMNVSGSTRNITLPD
LHWGPCELWVTASTIAGQGPPGPSLRLHLPDNTLKWKVLPGVFLLWGLLLTGCGVSLATS
GRCLHLRHKVLPRWVWQKIPDPANSSCGQPHMEEVPQAQPPGDFPILKVEEMELPVTEPP
QASTQLDSGYEKHFLPTPEELGLLGPPPGPKFWPEPTPGQERGGPLASSPSRGAD
Download sequence
Identical sequences G1M3A8
ENSAMEP00000013820 ENSAMEP00000013820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]