SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017441 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017441
Domain Number 1 Region: 18-409
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-56
Family L-arabinose binding protein-like 0.0042
Further Details:      
 
Domain Number 2 Region: 415-562,679-818
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-48
Family Phosphate binding protein-like 0.000000000126
Further Details:      
 
Domain Number 3 Region: 569-674,708-721
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000249
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017441   Gene: ENSAMEG00000016461   Transcript: ENSAMET00000018153
Sequence length 969
Comment pep:known_by_projection scaffold:ailMel1:GL193387.1:686541:709258:-1 gene:ENSAMEG00000016461 transcript:ENSAMET00000018153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNAT
SVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTT
RMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHVILLVSDDHEGRAAQKRLETL
LEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEARELEARVIILS
ASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHIS
DAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNE
DGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVT
IHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCVDL
LIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNE
RAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDR
FSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMI
IVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTM
YRHMEKHNYESAAAPVTPTPAHSKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIG
MRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVA
GGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQHREAGRSEGPSGRPGWAG
GPSSPEEQARDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTQYHPTDITGTLNL
SDPSVSTVV
Download sequence
Identical sequences G1MDL3
ENSAMEP00000017441 ENSAMEP00000017441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]