SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015358 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015358
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.1e-25
Family Ubiquitin-related 0.00000628
Further Details:      
 
Domain Number 2 Region: 525-576
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000146
Family UBA domain 0.0014
Further Details:      
 
Domain Number 3 Region: 203-255
Classification Level Classification E-value
Superfamily ARM repeat 0.00000575
Family Mo25 protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015358   Gene: ENSAMEG00000014579   Transcript: ENSAMET00000015997
Sequence length 580
Comment pep:novel scaffold:ailMel1:GL195741.1:7473:9347:1 gene:ENSAMEG00000014579 transcript:ENSAMET00000015997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGESSGGPPRPSRGPASAQGPASAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKE
AISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAA
GTNTTSASTPRSNSTSISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQNQMQQQLLSSP
EMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIAR
NPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSS
TSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSSGSGSGSSSSSATGNTVAAANY
VASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPVFTAN
PQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPG
PGSTGSGGPPGPTVSSSTPSETTSPTSESGPNQQFIQQMVQALAGASPPQLPNPEIRFQQ
QLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences G1M7N8
ENSAMEP00000015358 ENSAMEP00000015358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]