SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019169 from Ailuropoda melanoleuca 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019169
Domain Number 1 Region: 870-1004
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.2e-20
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 619-733
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000275
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019169   Gene: ENSAMEG00000018128   Transcript: ENSAMET00000019933
Sequence length 1165
Comment pep:novel scaffold:ailMel1:GL192529.1:945702:1022003:1 gene:ENSAMEG00000018128 transcript:ENSAMET00000019933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSNTWLEFFRSTFMTTSEDLPEIILILSLICTVGAFLNLHLKDFPIPLPVILFLIGCSFE
ILSFTSEQVQIYADAIQWMSPKVFFYLFTPIIFFNAAFDMDVYMLQKLFWQVLLITVPGF
LMNYILILWYLVSVNKLLLETTPWLLFSTILVSSDPMLTAAAIRDLGLSRSLVNLINGES
LMTSIMSLIVFNGIEDINLSLQKKVNHSLAFDILLEIWSYFLASFLFGILSSKLIQLWMS
TVFGDDVNHISLSFSILYLIFFICELFGMSGIFTLAIMGLFLNSTSFKPGVEALLLEKCR
FWNCLSFVALLMVFTFTGLLIPAHTYLYISFSDIYYSLNIYFTLIVLRLLVFLIMSPLLS
RLGHGFSWRWAFIMVWSEMKGTPNINMALLLAYSDLSLGSEREKSQVLFHGVSVCLVTLI
VNRFILPMAVSKLGLRDVTSTKYKSLCCTFQHFQELTKSAASALKFDKDLANADWNMVEK
AIILQNPYALSQEDPTEHQKVTCLGCNKEIDETLNFEAMELANRRLLSTQIASYQRQYRN
ETLSQSAVQVLVGAAGSFGEKGEYMSPETIKNYSESKKLLTFIRKLLLNWVYNTKKEKGI
PSRHRILRVCHKIVFTDEFEYIGYLVILMNMFPIIISWIPDLSDIYEHELRYCNYSFLAF
YILESLFKMAAMRKEYFLHAWNLFELAITLVGIIDIILIETNSITYTLDFILTVIFIKIV
RFLRILRILKLITPKLLQIIDQKMSHQLSFTYAILKGYVQGEADVITIIDQISSSKQVKQ
MLLRRIMKNIGHAMKELGYLEYDHPEIAVTMKTKEEINVMLNLAREIVKVFRSKGIIHKI
EGSEINKLIMAKKREILDFQPVIKPLTVEEALYHIPWLDKDKDHISFIQERARVVTFDCG
NDIFEEGDEPKGIYIIISGMVKLQRSKPGFESDQMLWESEEKDYQLIYTDFVITGEIIGE
LNCLTNEPMMCSATCKTVVEACFIPKNHLYEAFEQCCPHIEYKIWLKLGLSITAKKMRER
LSYEDWNYKMQLKLCNVCVKDIPKNTKTDIYDETVIYVILIHGAIEDCQLRKVYKAPSLI
PITCYQVQGIENFTKVMIVQTSVDVKQFRWNTRKYIPSCKASLPTAHCSVGEVEGVSHDC
ERQTEDDGKGLHSAAVARSPSPQSL
Download sequence
Identical sequences G1MII4
ENSAMEP00000019169 ENSAMEP00000019169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]