SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc12g02320.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc12g02320.t1
Domain Number 1 Region: 29-119,148-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.29e-25
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc12g02320.t1
Sequence length 233
Comment gene=Pc12g02320 Pchr_Wisconsin_54-1255_contig_Pc00c12:join(518422..518451,518781..519222,519321..519550)
Sequence
MSPLLRTYTRVSNLVVRLSRTNFNPGPKMSLEIHPASPADARELTEVFYGSFHSDLDTTM
FPKKPDVTEWWEKYFTTSIARSIAGETHDVFLKVTEGSEDGRIVAFAKWKLPVAPADRRR
NEEQIVWPPSSDKDLCDRFFNGMGARHEKWMGERPHYYLDMLGVHDSYQGKGLGSKLLKW
GLTRADAEGLEVYLSASPAGKPLYEKNGFRVVDTFSPFPDYVQVAMLRSPNKQ
Download sequence
Identical sequences B6GZV6
Pchr_Wisconsin_54-1255:Pc12g02320.t1 jgi|Pench1|85023|e_gw1.7.606.1 XP_002557123.1.37043 500485.B6GZV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]