SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc12g12470.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc12g12470.t1
Domain Number 1 Region: 23-199
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.61e-27
Family N-acetyl transferase, NAT 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc12g12470.t1
Sequence length 213
Comment gene=Pc12g12470 Pchr_Wisconsin_54-1255_contig_Pc00c12:complement(join(3002222..3002269,3002334..3002927))
Sequence
MASTQTLQGLSKPRLIYRAPEIFEEDIAFFHDLINDPTIQTLSTRRLPRPSHKRSAEEFI
KTLQDAILGVVICLPQNSAETETASSTETQVLNQPVQSSKPVPIGHLSLFSVTGPGYAHH
RNAMIGISLADGFRGKGYGGEAINWALDWAFQHLGLHRVSIGAFSFNHDALKLYRKLGFV
DEGREREAVYHRRTWHDIIPRHSLPPEASEMED
Download sequence
Identical sequences B6GYN1
500485.B6GYN1 Pchr_Wisconsin_54-1255:Pc12g12470.t1 XP_002558061.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]