SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc12g14740.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc12g14740.t1
Domain Number 1 Region: 168-254
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000251
Family N-acetyl transferase, NAT 0.013
Further Details:      
 
Weak hits

Sequence:  Pchr_Wisconsin_54-1255:Pc12g14740.t1
Domain Number - Region: 88-139
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0915
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc12g14740.t1
Sequence length 357
Comment gene=Pc12g14740 Pchr_Wisconsin_54-1255_contig_Pc00c12:complement(3524478..3525551)
Sequence
MARMVTSPCQGDKVTVTKPKDLVNQKTPHHASPSASPSALEHIASPGQSTDVATEDFEIA
SALKLIAISVTQQRRLAAKSLILHPTTLTLVALGFAYSVGAVYRDPSGWPYIFVICATAV
FATLGIVIRLLGRYNDEAEKVGTMNWLYGYDPSKDAGGTTTQEDPVFNSDSGVTFILVHR
FGGRIVGTLVMSIVYSDIEPHPKINARSLPKGKSYNAFIRAWTVQQGFRGYGVGAELLNE
AVMICYEHELKGLRFADSHANSLRVFPCILNYDMDQESAMWSSYLRKRVEANRQSRAVLE
ARLVDMSLHGNDSETTMMDTQMRLLCTQMKLEELIRSYFNVRLGKAVQAQTRWKKIS
Download sequence
Identical sequences A0A167WG62 B6GWW3
XP_002558278.1.37043 500485.B6GWW3 Pchr_Wisconsin_54-1255:Pc12g14740.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]