SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc13g01600.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc13g01600.t1
Domain Number 1 Region: 116-219
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000541
Family N-acetyl transferase, NAT 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc13g01600.t1
Sequence length 518
Comment gene=Pc13g01600 Pchr_Wisconsin_54-1255_contig_Pc00c13:complement(join(373552..374610,374664..375161))
Sequence
MSEVHGDSELVPSGPDLDYPLALAPRQVTLRDRVTVATLVPFASAEEVPRALMKYLSDQF
NKEIEKGDTYAMTEPIPLAQFGRYWFSNFGVVMLTGDIESAEQTHAMDRAGANWTKICLG
GFHIRPNYPGRSSHVCNGTFIVTDAARNKGVGRLMGESYLEWAPRLGYTYAVFNLVYESN
VASCRLWDSLGFKRIGRVPGGGSIKSQPGEFVDAIIYGRGLSLDGEDSVSQDRFEKIRYY
LKHGKYPRGADRAEKSRLRSAATHYKLLGGEDGEPERLMLKDKEVVSDPQQQYDIAQEVH
LKQHAGINKTTAAIAIKYHWVRIKETVNRVIRDCPQCKETLKSPPIPGTKDDDKSPSETM
SGMDMNSTMEQPPKEPVNDPQAMDEAPDEPPSYNPLMHQPIPAAMPGTVHPMAGFAPMPL
DPQIMQLQQQLRRYQQQNPMAGQFAPGPHNLGMSSFDDAMRYHTASNAYQMMVDDGSDPF
RQDVLGLVNPPAHELQHDAELLAKFEYGNPSDGNYDFT
Download sequence
Identical sequences A0A167X5R4 B6H1S0
XP_002558605.1.37043 500485.B6H1S0 Pchr_Wisconsin_54-1255:Pc13g01600.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]