SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc13g03430.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Pchr_Wisconsin_54-1255:Pc13g03430.t1
Domain Number - Region: 253-338,371-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000339
Family RecA protein-like (ATPase-domain) 0.082
Further Details:      
 
Domain Number - Region: 632-662
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00103
Family N-acetyl transferase, NAT 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc13g03430.t1
Sequence length 1035
Comment gene=Pc13g03430 Pchr_Wisconsin_54-1255_contig_Pc00c13:complement(join(796139..796271,796333..799307))
Sequence
MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDHAKDVIVHLHYIMSSVDVKQNKSVLWAYK
KDLLGFTSHRKKREMKIKKEVKRGIREPNQEDPFELFITLNQIRYVYYKETEKILGNTYG
MCVLQDFEAMTPNLLARTVETVEGGGLVILLLKSMTSLKQLYTMSMDIHSRYRTEAHDDV
VARFNERFILSLGSCDSCLVVDDELNVLPISGGKSVKPLPAPETTDESASGTKKELKEIK
ESLADSKPVGPLLSLARTVDQAKALLTFVDAIAEKTLKSTVTLTAGRGRGKSAALGVAIA
AAVAHGYSNIFITSPSPENLKTLFEFIFKGFDALGYLDHVDYTILQSTNPDFNKAVVRVN
IHRNHRQTIQYIQPQDAQVLGQAELLVIDEAAAIPLPLVRKLMGPYLVFMSSTINGYEGT
GRSLSLKLIQQLREQSRTGVKTDDTDIADRSTGKSAKGADKNLSGRTLREITLSEPIRYA
PGDSVEKWLNKVLCLDATLPKSHMNTQGCPHPSQCQLLQVNRDTLFSFHPVSEKFLQQMM
ALYVASHYKNTPNDLQLMSDAPAHQLYVLVPPIDEGATKLPEPLCVIQVALEGRISRQSV
LNSLSRGQRAGGDLIPWLVSQQFQDENFASLSGARIVRIATNPEYVGMGYGSRAMQLLVD
FFEGKFTNLEEENIAAEEQMVRVTDEELASSSLLDDNVHVRDIRSMPPLFGKLTERRPDV
LDYVGVSYGLTPSLHKFWKRGSFVPVYLRQTPNELTGEHSCVMVRTLSTGEADDAWLSAY
ARDFHKRFLSLMSYQFGQFPSVLSLSICEAANSGAKKDPTFKPRTLQKADLDAAFSPFDL
KRLDSYANNLLDYHVILDLVPALSDYYFANRLDGKVSLSGVQQSILLAIGLQHKSLDDLE
KELNLPSSQLLAMFLKIVRKVSTHFRNLIENEIEQSLPAQKVRVETSAAHDDEPEVNLQP
LPISLEDELREGSKKIDEEMLAKQRALSAANPDGPDGSKSSKRKKIETARDIYDKEIDSK
RQKMIKKGTEGRKKR
Download sequence
Identical sequences A0A167XAE0 B6H1Z4
Pchr_Wisconsin_54-1255:Pc13g03430.t1 XP_002558780.1.37043 500485.B6H1Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]