SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc13g07930.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc13g07930.t1
Domain Number 1 Region: 89-142,177-285
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.52e-22
Family N-acetyl transferase, NAT 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc13g07930.t1
Sequence length 287
Comment gene=Pc13g07930 Pchr_Wisconsin_54-1255_contig_Pc00c13:complement(join(1923381..1924162,1924264..1924345))
Sequence
MPSVKEGRVTKLKARGPRTTTRRVSNKIPLVEQTNALSIDDFIAQYVAPTQAEDPAKNDA
IDQPHPSQDQQQQDTTPTPRVDVYSAATISAADLEACLDLVELTSSEAYIASTVGWSRTK
KRKEMKLPDMKYLILRDTPNYSSGYSGQVPGGKQSDVADSNVPSSLKESDGSVSSSGTGS
PDVLGFLSFMVTYEDGKEVVYCYEIHLSPMARGRGVGKLLMGRMEGIGRAVGLEKSMLTV
FKSNEPARRFYERLGYEVDEYSPRPRKLRNGTIKDVDYLILSKKLKL
Download sequence
Identical sequences A0A167XMV9 B6H481
XP_002559219.1.37043 Pchr_Wisconsin_54-1255:Pc13g07930.t1 500485.B6H481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]