SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc13g13790.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc13g13790.t1
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.95e-23
Family N-acetyl transferase, NAT 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc13g13790.t1
Sequence length 184
Comment gene=Pc13g13790 Pchr_Wisconsin_54-1255_contig_Pc00c13:complement(3343210..3343764)
Sequence
MNELNFRVATEDDAAQLQQLVESAFRTEDSRKGWTDDLGLSSAFRLDVQEVLAMVTKPDS
VVLMATNNENTLLGSIGTSKRDANYARLFMLAVDTSKQRGGIGRQVLAYAEDYCQRTWGV
TTLGLNTLSNRKQLISWYSRHGYKMTGETTPFPREKFESLLLPDDLCLVEFEKVLGIAPA
EQAT
Download sequence
Identical sequences A0A162BZ76 B6H540
500485.B6H540 Pchr_Wisconsin_54-1255:Pc13g13790.t1 XP_002559790.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]