SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc16g02400.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc16g02400.t1
Domain Number 1 Region: 33-170
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.6e-21
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc16g02400.t1
Sequence length 172
Comment gene=Pc16g02400 Pchr_Wisconsin_54-1255_contig_Pc00c16:544665..545183
Sequence
MAPQYETGGMGGMPGLTISDIHALKRNEALEILARISRVEKKTFPTNEAFPFGEDLWRKK
PNTRVLYAIRAKGSQSDLIAYAVYVRQKGIALLHKVCVTEPNRRRGVGQEVLSYIQQRLR
KEGCQYIQLWVDQAREPARALYLRIGFEEREVIPDYYAPGRTGIKMVLDLQA
Download sequence
Identical sequences A0A162CM99 B6H733
XP_002560612.1.37043 Pchr_Wisconsin_54-1255:Pc16g02400.t1 500485.B6H733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]