SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc16g03600.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc16g03600.t1
Domain Number 1 Region: 7-185
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.75e-19
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc16g03600.t1
Sequence length 205
Comment gene=Pc16g03600 Pchr_Wisconsin_54-1255_contig_Pc00c16:complement(join(817614..817837,817906..818299))
Sequence
MGSATNSLVLELATPEDIPAITEVWFASFTQPVIGKLFPNTPGMHQWHRDWHLGDIQKPH
HRYLRVVDTESKDEQGRPRLVAFGKWDLAMPDERGRRFPQWHADSPYQECEDFIAELEQA
RKRVMGDEKHYYLDTLGTHPDYQRRGAGSMLVQWGCDLADKDGVAAYVDASKEGASLYLK
HGFVNFNPPGSDVAAMARRKAAPSC
Download sequence
Identical sequences A0A162CN33 B6H7S4
XP_002560719.1.37043 Pchr_Wisconsin_54-1255:Pc16g03600.t1 500485.B6H7S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]