SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc16g03890.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc16g03890.t1
Domain Number 1 Region: 1-85,128-192
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.56e-24
Family N-acetyl transferase, NAT 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc16g03890.t1
Sequence length 230
Comment gene=Pc16g03890 Pchr_Wisconsin_54-1255_contig_Pc00c16:join(886545..886935,886987..887288)
Sequence
MGFVVVPATLPDIRAIYDVWFAAFKGQLILDLIYPGTDINDEAFRKVHTEGALEYWKGLS
TEHTFQCIDTDTGKIAGMATWQVYWRERTAEERQKPWIGWLEGDQRSRAEGFLEQLWEKR
EKWIGPKKHVYCHTVAVHPDYQGKGVGAQLMQWGMNVAEQLDLPVYLESTVEGVPLYKKL
GFQTLSEGIVFKPEITRVDKEVRAPLMAKMPTSAGNMTFEEWAEGKTSSV
Download sequence
Identical sequences A0A167PVB0 B6H7Z8
XP_002560746.1.37043 Pchr_Wisconsin_54-1255:Pc16g03890.t1 500485.B6H7Z8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]