SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc16g05160.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc16g05160.t1
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.32e-22
Family N-acetyl transferase, NAT 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc16g05160.t1
Sequence length 198
Comment gene=Pc16g05160 Pchr_Wisconsin_54-1255_contig_Pc00c16:1216549..1217145
Sequence
MPGFSFPPDFTIPTPRLQISPFNPNNPAHCAFLVQLWNTDGFISSCGKTGITTPEKAHSF
LKGRVSEYYAYHGYGTFLVSRQTEDGVKPIGTVSLTRGIPPGPHYLAPDIGFAMLPEECR
KGHATEAAKALLEYAGKNLGVEAVFGFCSPANRWSRGALENIGMEFRGVKPLKVFGGEDS
AVYVLPGMSGDLSVYNLD
Download sequence
Identical sequences A0A162BDM6 B6H9C3
Pchr_Wisconsin_54-1255:Pc16g05160.t1 500485.B6H9C3 XP_002560862.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]