SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc18g04610.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc18g04610.t1
Domain Number 1 Region: 1-123,150-235
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.77e-20
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc18g04610.t1
Sequence length 241
Comment gene=Pc18g04610 Pchr_Wisconsin_54-1255_contig_Pc00c18:complement(join(1095212..1095250,1095307..1095876,1096001..1096117))
Sequence
MSIEIVPLAQTDIPGAVDCVQKAFANDPYFRWAFNDSSKFNIQRNAASLAAHFQYGINCD
CPISVAKITRAANESKSNDDIRLPAGTVVGVAWWYSPQAHSTTQSWSVWAQDWLLSFRQL
MNNIRFLGRGGLNVRRYWIWKQVQQTAHDAIWQDPRGYYFCNVVCVDSKARGMGVGKKLM
ENVMDKADRENMPCYLESSKGYPNVGIYEKMGFELVKEIECVDGGDVCKLYCMIRNPKSK
E
Download sequence
Identical sequences A0A167WWX4 B6HBQ5
500485.B6HBQ5 XP_002562294.1.37043 Pchr_Wisconsin_54-1255:Pc18g04610.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]