SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc18g05510.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc18g05510.t1
Domain Number 1 Region: 304-410
Classification Level Classification E-value
Superfamily Bromodomain 6.28e-35
Family Bromodomain 0.000049
Further Details:      
 
Domain Number 2 Region: 93-227
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.12e-20
Family N-acetyl transferase, NAT 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc18g05510.t1
Sequence length 415
Comment gene=Pc18g05510 Pchr_Wisconsin_54-1255_contig_Pc00c18:complement(join(1315354..1316424,1316482..1316658))
Sequence
MDKVESQASDELNLAAKRTACEEQNIAPNAKRAKHIHDGLTQADGKAPAITRRVPFPEKP
AVVEERNGEIEFRVVNNDGSRESTIILTGLKCLFQRQLPEMPKEYIARLVYDRAHLSIAI
VKMPLEVIGGISFREFRDRKFAEIVFCAISSDQQVKGYGAHLMAHLKDYIRATSPVMHFL
TYADNHAIGYFQKQGFTKEITLDNSIWRGCIKDYEGGTLMQCSMLARIRYLEVGRMLLKQ
KASVLAKIRTLSKSHVIHLPPQQWANASDGVVVPIDPLSIPAIRETGWSPGMDELAREAS
HESRFRGPHFNEFRRFLNEIQNHKLAWPFLNPVNKDEVPGYYDIIVSPMDLSTMEERLES
YTTPKDLVRDLKLILSNCRQYNDATTVYAKCAVKLEKYMWKLIKEIPEWSYLLEE
Download sequence
Identical sequences A0A161ZIW1 B6HC71
500485.B6HC71 Pchr_Wisconsin_54-1255:Pc18g05510.t1 XP_002562378.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]