SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc20g03770.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g03770.t1
Domain Number 1 Region: 12-190
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000448
Family N-acetyl transferase, NAT 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc20g03770.t1
Sequence length 211
Comment gene=Pc20g03770 Pchr_Wisconsin_54-1255_contig_Pc00c20:complement(join(864279..864903,865022..865032))
Sequence
MASNTINNEVHDMTIVRGTVDTVPAVLHLLDTAVQWLVSHDRTGQWGAAPFSENPQRTEQ
LREFATTGHGLWLAIKVANNTPILCQNRISNIKPQTMNGEAPGVIVGALALGERTPYVTP
VSEPELYVRLLVTDRQCAGNQIGKRLLDHARDLASKAGVSLLRVDCYAGGDGKLVQYYES
QGFKRFESLDVEGKWPCQVLAQWLDEIEGES
Download sequence
Identical sequences B6HGU0
500485.B6HGU0 Pchr_Wisconsin_54-1255:Pc20g03770.t1 XP_002562927.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]