SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc20g06000.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g06000.t1
Domain Number 1 Region: 264-360
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000219
Family N-acetyl transferase, NAT 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc20g06000.t1
Sequence length 367
Comment gene=Pc20g06000 Pchr_Wisconsin_54-1255_contig_Pc00c20:1363754..1364857
Sequence
MLIYSSLEAEHTSIPPIVTVSDTKTAAPETLNVDSTRSNNNRNNTNDNDDDNPVININKP
IVSTFSASPSILALARSQLLALLSYVKVNLLPPYLSYLAQAAKATSAEAGNTSVSMSPGT
TNNTNPNNTSSVPLIPEPDPQAFLIGSLHTGLFSLLQRSGYYTQSDPIPNIRVHRFDDPP
YYKYFFRRFDFSPDEASGRSADLPFADLSLPAGYRFHDREGREGVLSKHLDLVQSRTHIP
RPRTQLSTMPGVAVYSDSGSSDADEMPIAWGFLGVDGALATLHVEPEHRGRGLAVPLSKA
IMRRGMSVDGVFGAGSVNSEDSQTRERVGAWAHAEVAGYNNASRRVMEKIGGQVLTTVTW
TVIELLD
Download sequence
Identical sequences B6HFS1
XP_002563129.1.37043 500485.B6HFS1 Pchr_Wisconsin_54-1255:Pc20g06000.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]