SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc20g10010.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g10010.t1
Domain Number - Region: 336-405
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0848
Family N-acetyl transferase, NAT 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc20g10010.t1
Sequence length 508
Comment gene=Pc20g10010 Pchr_Wisconsin_54-1255_contig_Pc00c20:complement(2316215..2317741)
Sequence
MTAATESHESTTTSKKKRSRRGNKGSTPCPVAVKSKKALFVDEIGGSLIDQYYEKRNSDD
ANSGISSVSLMDHLRSNAAHAASSCSSSASFHTIPNSSPATSVNSHEPVVTQPQVPAKTN
VLHPVTDSFDAKAEGRDQDAVFRLDDFKTMASIHQIAALHGKVAHMGILDHSYRFFVNES
RTAALSFKVQNGVAVIGGDPLCNKDEIPELLSEFAAYRQRHHLSIAFMGASESFLKDYAK
PNGWTTIRFATERVLNPQTNDVILENNGRRILTKSRQLMNKSKGGITMGVYAPTVHGINQ
ELQTNLITIYDAWRAERNASASPQAFITVYDPFAVPDLMTFIYTRTPDGTINGFAALRRL
GSGGYHVDPCIAAPGSVNGISDLLLIMAMALLRRAGVSYLGLGVEPLQSLTREDVSGMPW
PCKKFTRGLYGHAFHRLPIRGKKAYHDKFHPDPTQDSGLYLVFPSGIPSPRHVLAMTHMA
NISLRKIFRADVEACVLTRKLKAGGDTR
Download sequence
Identical sequences A0A167S3D8 B6HFK2
Pchr_Wisconsin_54-1255:Pc20g10010.t1 XP_002563495.1.37043 500485.B6HFK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]