SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc20g14310.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g14310.t1
Domain Number 1 Region: 6-366
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.75e-79
Family N-acetyl transferase, NAT 0.00000431
Further Details:      
 
Weak hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g14310.t1
Domain Number - Region: 373-426
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0111
Family Eukaryotic type heme oxygenase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc20g14310.t1
Sequence length 500
Comment gene=Pc20g14310 Pchr_Wisconsin_54-1255_contig_Pc00c20:complement(join(3329379..3330321,3330376..3330640,3330697..3330972,3331037..3331055))
Sequence
MASEAGWSCDANDAVHVTVIQPGEKKPKTLSTFHPEFTYPIFGDDEQIFGYKGLIIRLRF
AAHDLRPHVHISYDEKFKSVGDTAAVDLLDTLKPFVQKEAFANLQDYEQAVQNDPDAKDF
KPPGEFVIGYEVDDRKYEIWAGSLANPEVRKILDRMQVLVSLFIEAGTPLETNDPEWTLD
RWRVYFVYEKVTPPTPTASSYSIVGYATTYRYWYYQRDQSQTPTVKNDAFPPPEVNISEL
PARNRIAQFLILPSHHRAGHGTHLYTTIHAACIADPTILELTIEDPNEQFDALRDTADYC
LLRPEFLKHNVNLNPDPLGAYSQKKRPRNVPTSALIPTKLLHDIRKSFKIEPTQFAHVLE
MYLLGQIPQSHRLAGGTNLARLLIKKFKAENENDRRYYWWRMLTKQRLYKKHKELLNELE
LLDRVEKLDATVQNVEEGYEITLDALAGRLPEDESDEEAEANEQASKAPTGSRDRRAKRK
LTVMDDEEEDGTELAKRPKV
Download sequence
Identical sequences A0A167RSB1 B6HHB7
Pchr_Wisconsin_54-1255:Pc20g14310.t1 500485.B6HHB7 XP_002563909.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]