SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc21g02280.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc21g02280.t1
Domain Number 1 Region: 16-186
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000279
Family N-acetyl transferase, NAT 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc21g02280.t1
Sequence length 383
Comment gene=Pc21g02280 Pchr_Wisconsin_54-1255_contig_Pc00c21:565737..566888
Sequence
MIAAEIPSLPAGESPDLILVPATASERIASIKLNSVAWKGPLDVETYIERENHLLQQRLT
RDGLTCWILVDRNEPEDERTILSSCESYRKTALLAHNGQVEKISTYGVGSVYCRPDFRGK
GYAKRMLEELSTKLETWEMEKEPRRKSLFTVLFSDIGKKFYAQFGWRPFSSSHMSLPAAT
GALEKAVTRDLFAEDVHKCLCSETVLAKLREQMCLASQKASGAKIAILPNFDHFVWHWAR
EEFYAENLFSERSSPVVKGAGDDQARVYCAWNRNFGERPEDNVLYILRWVYDDPASPAEE
QATVQAMAAILRRAQQEAHEWNMSKVEFWNPTPLLQKAVALVDPKAELVHREKESIASLR
WTGEEQGLGKDVEWWLNEKYTWC
Download sequence
Identical sequences A0A167TAF1 B6HJM2
500485.B6HJM2 XP_002567292.1.37043 Pchr_Wisconsin_54-1255:Pc21g02280.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]