SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc21g08470.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc21g08470.t1
Domain Number 1 Region: 17-194
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.45e-17
Family N-acetyl transferase, NAT 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc21g08470.t1
Sequence length 202
Comment gene=Pc21g08470 Pchr_Wisconsin_54-1255_contig_Pc00c21:1974612..1975220
Sequence
MNVFHSKGLQYRSFNSPEDDDFFHSMQSDPLTFTNSCVSLTRPVGRRFTKNIRKHLTENS
LLFVVIYRISDYVPDYPVASRMQPRVWVQAEPERIGIMFLKSASPDMAHHRCSECGIDMK
KQYQSQYGGLAIKWMLDWAFRSANMHRVECNVFGWNTGIVEIYKSAGFFEEGKRRECLFK
DDTWWDEVHLGILKEEWQLIRQ
Download sequence
Identical sequences A0A167TSK0 B6HLY9
Pchr_Wisconsin_54-1255:Pc21g08470.t1 500485.B6HLY9 XP_002567886.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]