SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc21g13960.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc21g13960.t1
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.66e-23
Family N-acetyl transferase, NAT 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc21g13960.t1
Sequence length 177
Comment gene=Pc21g13960 Pchr_Wisconsin_54-1255_contig_Pc00c21:3297835..3298368
Sequence
MKIQIEPAQFPEDADSILSLFSDYATSLGIDLTFQSFQEELDSLPGKYAPSQGGALLIAR
VDTGVHEYDTDGLVDTIIPPQFPSALGCVALRRSSDGWCEMKRLYVLKEARGERLGEKLV
QAILAQARALGYRGMRLDTLPEMTAAQRLYRKYGFVDIAPYYDTPIQRTVFMGCELL
Download sequence
Identical sequences A0A167U8H1 B6HNS1
jgi|Pench1|66037|e_gw1.1.2402.1 XP_002568413.1.37043 500485.B6HNS1 Pchr_Wisconsin_54-1255:Pc21g13960.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]