SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc21g14110.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc21g14110.t1
Domain Number 1 Region: 19-117,159-235
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000227
Family N-acetyl transferase, NAT 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc21g14110.t1
Sequence length 254
Comment gene=Pc21g14110 Pchr_Wisconsin_54-1255_contig_Pc00c21:complement(3332600..3333364)
Sequence
MASQRQRPDIGLRVDIIHQPEDIIQAFDCVCEAFGRQAQDGIWIAMNPGWDTPQGRSNGA
ERMVARWRHRTSDKDGLPNTIFLKATLPCPRFEDRRIIVGFGIWVQASSVEGHGDPPVED
LANSMDLNALYPDNEPERRYLCQVVSSLHRRRTEVIKQRATAVPPAVLILDMCAVDPAHQ
RKGIARELVQWGIDEAQRRGNLEAITEASSMGRHVYGQMGFQADGSEIEYVVDDEFASRP
KPPNLFMRTQGGVA
Download sequence
Identical sequences A0A167U8S9 B6HHN4
Pchr_Wisconsin_54-1255:Pc21g14110.t1 XP_002568427.1.37043 500485.B6HHN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]