SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc21g23900.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc21g23900.t1
Domain Number 1 Region: 10-161
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.57e-28
Family N-acetyl transferase, NAT 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc21g23900.t1
Sequence length 179
Comment gene=Pc21g23900 Pchr_Wisconsin_54-1255_contig_Pc00c21:5619952..5620491
Sequence
MLSSPGPPATVRSALVSDAARIAELGAHVFSASFGHSVEPHELAAYLKTSYSTAAIQEDL
TDDFKDVLVATDANDQIVGFGYLNCGSDEPCLANVDHKVELQRIYIDPGAQGKGVGSLLA
KELECLARERGFRNMWLGVWKENCKALQAYERWGYRVVGGHSFTIGSVVQKDLIMLKSL
Download sequence
Identical sequences A0A167V175 B6HJ75
XP_002569354.1.37043 500485.B6HJ75 Pchr_Wisconsin_54-1255:Pc21g23900.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]