SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc12g09540.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc12g09540.t1
Domain Number 1 Region: 12-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000199
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 84-120
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000611
Family Zn2/Cys6 DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc12g09540.t1
Sequence length 182
Comment gene=Pc12g09540 Pchr_Wisconsin_54-1255_contig_Pc00c12:join(2232305..2232419,2232468..2232522,2232591..2232969)
Sequence
MKRQVQKPETRTGPRMWKCKECSSSFQRLDHMKRHALTHHTVKSHLCLFCGSSFSRGDVL
RRHWKSCKARVEGGYEIPEPERGGKHKRACDSCASLRKACNGEMPCAECTQRAKQCAYQR
LLDDELPLPSTSQALPETRDVERASSSNDAPKVSESSWDLGPATLYPPHMKIIAGRQKFA
LG
Download sequence
Identical sequences B6GZI2
500485.B6GZI2 Pchr_Wisconsin_54-1255:Pc12g09540.t1 XP_002557781.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]