SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc13g06320.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc13g06320.t1
Domain Number 1 Region: 21-201
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.5e-36
Family N-acetyl transferase, NAT 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc13g06320.t1
Sequence length 239
Comment gene=Pc13g06320 Pchr_Wisconsin_54-1255_contig_Pc00c13:complement(1559972..1560691)
Sequence
MASLHPQGPLVPFTPALLPTSQTIPGRTILLEKLSPKHADDLFTLAGGLEPSKEALWDYL
PDGPYPDAEAFKASISSKSTSTDPFFYAVIDKRNSLLTFGKAIGYLSFMRMTPDHLGIEI
GNVLYSGALQRTTGATEAIYLLAQHAFHNLGYRRLEWKCNSLNEPSRRAALRLGFSSEGV
FRQHMIVKGRNRDTAWFSILKDEWDTSLKAALEKWLDAGNFGADGGQIRSLQDLRAQLR
Download sequence
Identical sequences A0A167XIJ7 B6H3F9
XP_002559066.1.37043 Pchr_Wisconsin_54-1255:Pc13g06320.t1 500485.B6H3F9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]