SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc13g14970.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc13g14970.t1
Domain Number 1 Region: 38-181
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000016
Family N-acetyl transferase, NAT 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc13g14970.t1
Sequence length 197
Comment gene=Pc13g14970 Pchr_Wisconsin_54-1255_contig_Pc00c13:3626481..3627074
Sequence
MASAPPTVGLPPKTWTRDNREFFISTEPSLLSVKAVNAAFDSDFVYWQKKPFSEDVLWQM
LHGALSFGVYRWTQPESVNESTTPCSENTEQIGLARMVTDGCTFAYLSDVYVLPEYQGNG
LGKWLVACVAETFSKENMPYLRRIMLLTDDERMQAFYMKMFGVKVVGREERKDIGRDLVF
MCARPHAQPSLDPKRLL
Download sequence
Identical sequences A0A167Q4P2 B6H2P8
500485.B6H2P8 XP_002559899.1.37043 Pchr_Wisconsin_54-1255:Pc13g14970.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]