SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc18g03210.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc18g03210.t1
Domain Number 1 Region: 26-196
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.81e-26
Family N-acetyl transferase, NAT 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc18g03210.t1
Sequence length 215
Comment gene=Pc18g03210 Pchr_Wisconsin_54-1255_contig_Pc00c18:747389..748036
Sequence
MASKEEFVTVKAFLPTVPLPANSERPAITTDRLLVRALQSTDLEALHVLRTQEEVMKWTS
AGCIDDSIEKTKSKLDPFLPPNDRVTANCAICLKETGELIGIGGCHLYPGRHGWPEVGYM
LRTEAWGKGIATEFLSAWLRFWSELPRTQREVRVQKEMVIGEGIVDEHLIAITEASNSGS
QRVLLKCGFERFREFVEVDDTKTVNLVAFRFLPKR
Download sequence
Identical sequences A0A161ZIG2 B6HB89
500485.B6HB89 XP_002562161.1.37043 Pchr_Wisconsin_54-1255:Pc18g03210.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]