SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc20g11080.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g11080.t1
Domain Number 1 Region: 71-107
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000123
Family Zn2/Cys6 DNA-binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 12-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000268
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  Pchr_Wisconsin_54-1255:Pc20g11080.t1
Domain Number - Region: 124-160
Classification Level Classification E-value
Superfamily ssDNA viruses 0.0737
Family Microviridae-like VP 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc20g11080.t1
Sequence length 404
Comment gene=Pc20g11080 Pchr_Wisconsin_54-1255_contig_Pc00c20:join(2557688..2557848,2557900..2558374,2558454..2559032)
Sequence
MSPPADIAPLWFQCDYPDCNAKYRRKEHLNRHRNHHNGETILACPYCESVLTRNDLLRRH
IRTYHPQRHAPPSRKSRACSACHARKVRCEGVLPCNACQHRGIICVPAGGETAGEQQFCI
DDLRPLPPVSTINDSVSEAPRWIAHDYIDIYFNSFHPEWPFLHRGTFDFAKEPCVLVQSV
VAIGLWVKGTQEARAASIQLHDRLCSAFYAQMDQWCISNSSPRQRTNTPWPITTFQSVLL
NIILALFIARENVSMDLSMRCRLPDDKYKLLTALVQSCRQYGIFSYPNMLLQHEADAPLT
LVYVSVEEIKRFGLALYKVCRLSTSFHLTGESASGGRNILLTLADLSFCMPDSDELWNAP
LGSESEVLSKADLSTAGRDNGDVKNWISQASALVHDERVGFDWI
Download sequence
Identical sequences B6HG00
XP_002563597.1.37043 Pchr_Wisconsin_54-1255:Pc20g11080.t1 500485.B6HG00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]