SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc22g07330.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc22g07330.t1
Domain Number 1 Region: 2-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000626
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 71-115
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000419
Family Zn2/Cys6 DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc22g07330.t1
Sequence length 866
Comment gene=Pc22g07330 Pchr_Wisconsin_54-1255_contig_Pc00c22:1751529..1754129
Sequence
MYVCRLCNKNYQSRGSLTRHVRNHSVDSSQHVCPTCGVAFSRRDLLRRHVQIHRPEDPPV
SPSTGVKLHNSAPRRRCHTACQPCRMARIKCTGEQPCTQCISSQAECWFEARAHRVSRIV
EVDPTQDQARDLNLEDSRVEDGASPKTNREPAMPPVSDMLQSPVSNSNSPNISFLPSDHS
MSQQDQASEMSQMPEIDFSWAGTFPCNTASWPWLHESLFLQGNPMLNWPDSFGASPLNQM
DEAAVGLTLVPDESAQPTVSDIALPTEPISFDTPATPSNRIDIRVSEHGKEYETSQPELP
DSLDLKAEKAWQESIVHELVTYASGQNITPGSQMARSLYWQSISIRIAEAFNFGSWRSGE
PKLSLFRMMEMYRENFSPLWPLLSGKDFDPDHLNPMLFLTVVSIGCMYGCDRECKFGNML
HEEIRRHLAGSLIGLEDGEGDILWLGQARLLTQVAALYFGQRRAFSYAQHLGAIIAAQAR
RMGLFSTCGSIISADSSLEQQVAAWHNSESRKRLAFGILRADVFTSVLLNTRPLLSAEEV
CLDFPTNDEIWEGLDEAPADELVARLKAEAPKTLALPFCDLVRVATDRGETILSMNARGY
ELLIFGLQDQVWRFSHDRSLFTRLIGKSDGALTQNQSTPESISGSFSIPSSSQSDQLGLT
YRQMHDLRDDRIRITQTLQRWEQSFTATRTTQTFAKDRSSVMSSMLLLHISHLRLSAPLA
DLHTAVYNLIDKSSLDQTKLQALYQWTSSPEAIQAVNHICQIWLLLHNESHRDGSEKAKY
NLLAFSGLHHAAVVIWVIAGANSEQTDDAPELPGSYNMAPIPIRRSHNQLLLKTVIGLYQ
RLIPRGWSSFAAAAEYMAAHPFPTCP
Download sequence
Identical sequences A0A161XT98 B6HQY3
500485.B6HQY3 XP_002564757.1.37043 jgi|Pench1|83125|e_gw1.5.431.1 Pchr_Wisconsin_54-1255:Pc22g07330.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]