SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Pchr_Wisconsin_54-1255:Pc22g12680.t1 from Penicillium chrysogenum Wisconsin 54-1255

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pchr_Wisconsin_54-1255:Pc22g12680.t1
Domain Number 1 Region: 16-167
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000022
Family N-acetyl transferase, NAT 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pchr_Wisconsin_54-1255:Pc22g12680.t1
Sequence length 179
Comment gene=Pc22g12680 Pchr_Wisconsin_54-1255_contig_Pc00c22:2976568..2977107
Sequence
MASSSVFPFHLGETSNERVKLTPFNPEQHCETFFRISSFHPEIYTHLPLLPPTSATELKS
LFYSDSTNHILSFSNPESFAFAIIDKTRPPSPEDPEGELAGTVSFIRTSPTNLRTEIGFI
VILPPYQRTHVATNAVGLALRLAFACTENGGLGLRRVHWSASTMNLARPKKWNTRRCAK
Download sequence
Identical sequences A0A161ZGS5 B6HSA8
Pchr_Wisconsin_54-1255:Pc22g12680.t1 500485.B6HSA8 XP_002565211.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]