SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|18737|gm1.3099_g from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|18737|gm1.3099_g
Domain Number 1 Region: 122-439
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.26e-44
Family Glutamine synthetase catalytic domain 0.0012
Further Details:      
 
Weak hits

Sequence:  jgi|Zasce1|18737|gm1.3099_g
Domain Number - Region: 15-111
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000157
Family Glutamine synthetase, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|18737|gm1.3099_g
Sequence length 446
Sequence
MDYFHDATHASHFEGFISENPQIEFVRHVYIDFSGIVRMRILTVEYSSKLYRSGRSYGCG
PALMMFNVSGTSEAKLPRPVKHQKFDLVPDWTSLRVCEFAPAHAWVMCFVRAAEETADPF
FVCPKFLLAKVLERARAEADLDVLIGFEIEFTLLDSTLQVAKSLDVPQGFNSASGLRDEK
VAFFEEVVRALRRSRIGVTHFHVECFHELEIATDPFPPMEAVDNLIYTLELIRTIALRHG
YKATMSILPVTDDPTGVAPANQLQPHFSISKKGPTADHFLAGILTRVDEITPFAMSSYDS
YLNPFVDHGGYYASWGTENRDVVVRRVEDSHWEFRISDATNNFYLTLAVMLSAGLDGIRD
KTALTWGDLRLDFKDYTKEELAALGVTKRLPTSLRLAVDVLRESEYLEGLLGKEMKSAYI
LVKDTDERAFSSMREEEKRLQFIKHF
Download sequence
Identical sequences jgi|Zasce1|18737|gm1.3099_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]