SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|23298|gm1.7660_g from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Zasce1|23298|gm1.7660_g
Domain Number - Region: 217-346
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.00549
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|23298|gm1.7660_g
Sequence length 391
Sequence
MGDEFDDSTYDRPIWQVLLKTGITHALGLLVYSQLNHLLHVPSKHNARLFRLIVFAFLPT
VILGQFAFDIVKAAIRLLQNPHEVDVQSKLRALKFYWDGMLGVRCTTEDEGVEEREETIR
LLDIAAAEDVQPQKPKWTWKRVSGILLCLLAIFQAVGIIVTFARRSLQRSCRKEEIPCRD
TPWYTCDEPTQIRYNCSHSFTGLDFRNLYVACASIIISVLSIYLLAAGNTWTYAPSTSLT
GEEDVATRSSAVLGEMQRLLMDYIFGTLIQEFIAVETYYDRWGDNGTPKYVTIFMGTLDR
ISMSPVEWVLIILAVFMVTVFKQDIAARLGVKTKLVYGVLIAAIGIWLTLDNVLLFVTDA
GHFILGHYGSEADGNWGEKWSDPIEKWVPVM
Download sequence
Identical sequences jgi|Zasce1|23298|gm1.7660_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]