SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|57225|fgenesh1_pg.29_#_85 from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|57225|fgenesh1_pg.29_#_85
Domain Number 1 Region: 116-365
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 5e-70
Family Glutamine synthetase catalytic domain 0.0033
Further Details:      
 
Domain Number 2 Region: 23-113
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 4.84e-18
Family Glutamine synthetase, N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|57225|fgenesh1_pg.29_#_85
Sequence length 389
Sequence
MLANKNSQADPVYLSNTANLEKYLKLPQRGSVIAEYVWIDASNGVRSKCKTLPKKPESVS
ELPEWNFDGSSTGQAPGDNSDVFLRPVSMYPDPFRLGDNILVMCETYMSDGKPNAYNFRH
DAAVVMEKHAKHEFWFGLEQEYTLLDTTGWPYGWPKNGFPAPQGPYYCGVGAGKVFCRDI
VEAHYKACMYANINISGTNAEVMPAQWEYQVGPCEGITLGDQLWMSRFLLHRVAEEFGAK
ITFNPKPIPGDWNGAGLHTNVSTKEMREKGGMKHIEKAMESLAGRHKEHMKVYGEGNEAR
MTGAHETASYDKFTWGIANRGSSVRVNRDVAEKGFGYFEDRRPASNADPYQITGMIVETI
CGKVEGADVFSSSQQQQQELEMVVPVAKP
Download sequence
Identical sequences jgi|Zasce1|57225|fgenesh1_pg.29_#_85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]