SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|60965|fgenesh1_pg.62_#_25 from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|60965|fgenesh1_pg.62_#_25
Domain Number 1 Region: 121-488
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.41e-91
Family Glutamine synthetase catalytic domain 0.0000436
Further Details:      
 
Weak hits

Sequence:  jgi|Zasce1|60965|fgenesh1_pg.62_#_25
Domain Number - Region: 24-114
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0392
Family Glutamine synthetase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|60965|fgenesh1_pg.62_#_25
Sequence length 490
Sequence
MAITDDPSQLEHADLEELLKNDNSVKVAGVDIDGQLRGKLMSKKKFFSVAKSGFGFCSVI
FGWDMHDQTYFKELKISNAENGYRDITAEIDLTSFRRIPWENNVPFFLVSFREPEGGSLS
ACPRSLLERAVDKISAKGIGALAGAEYEFYTFRAPSHTHQSPEERNSSATATFLQNNPVT
NLPSLEEGMFGYSLTRPVHNQDWYYDIFNASIKFRCDVEGWHTESGPGVYEAALEYGEIK
SMADKASLFKFTVKSISSKYGITPCFMAKPRENLPGNSGHMHISLKDNKTGANLFVREKE
DPNPPHEGLENVSDMGRCFLAGVLEGLPDIMPILAPTVNSYKRLVENFWAPVTVSWGLEH
RAASIRLIAPPTCPPKGTRLEIRVPGADTNAHLVLGAILALGYRGIEKKLQVSIPPLGKG
QDVGGVEDKGERLAKSLKDATARFSRKNSVAREVLGNDFVDHYTGTREHEISLWDEAVTD
WEVRRYIETV
Download sequence
Identical sequences jgi|Zasce1|60965|fgenesh1_pg.62_#_25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]