SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|66787|fgenesh1_pm.19_#_131 from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|66787|fgenesh1_pm.19_#_131
Domain Number 1 Region: 544-880
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 7.06e-62
Family Glutamine synthetase catalytic domain 0.00024
Further Details:      
 
Domain Number 2 Region: 265-416
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.0000000000000034
Family TatD Mg-dependent DNase-like 0.071
Further Details:      
 
Weak hits

Sequence:  jgi|Zasce1|66787|fgenesh1_pm.19_#_131
Domain Number - Region: 437-516
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0275
Family Glutamine synthetase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|66787|fgenesh1_pm.19_#_131
Sequence length 882
Sequence
MAHTTTESLDELRKIVRTCPIIDNHAHNLLKPQGLKAEDFLSATSEAEDEALEDHVKALP
HFRAQRQLRTLYDVPHDADWSAILKRRRELLETDPNGLIARCLEGTHTILVDDGLYGDFE
DYSWHDQFVTTPCKRIVRIEAVAAEILESLHQQGKLPAGVDIADEEACSLAWLDFIAAFE
ESIAASLEDSEVVGLKSVICYRSGLDIIVGRDADVSEAGLRSFRRHFLPSYVQDKFRVES
KGMCDALVISACKLVDAARKATGIAKPIQFHTGLGDNDISLLESDPACMQPLMKHFPSVP
IVLLHSSYPFTREAGYLATVHKNVYLDIGLVFPMVSRDGQEKVVRQALEITPTSKILWST
DGHHHPETYYLANLQGRVALEKVLCEYVTREDLTVAQAVQAVKDVLFFNSNLLYNLDLVL
PATGGRSVSIHSKSNSRDTARQGSVQYVFVQWLDYNAQMRTRWLPIVEFDKMMTSGPGRF
AISNGNLGTTPNDHMSSICDPVGSIYVEPDLSSFRLLQPTGPVKNAATVMARFTDEQGVG
LAACPRYTLQRIVHSFEQEYDINFLVGFEIEITFCRRGPKGSDDPFSPLDANHAWGTFSD
EQYMTSVALMTSIGTVLQNIGIPIQALHSEAGAGQYEFVLPPLPPVQAVDTLIQAKQCIQ
QIATQNGLRATCHPMPFPGIGTAAHAHISLNTSTLQLSQLETIEQSFIANILAHLPAITA
ITMPHPVSYGRVADNSWTGGTWVAWGTNNRETPLRRVSAQRWEIRCLDGLANMYLALGVI
LGVGLDGVRRSVELKIRDCRMNPTKLSEEEKAGLGIVERLPRGFEDALGALEKDVGEVGR
MVGGGEGEGLLVRNWVAVKKAEQEMLNQMGEGERRAWLIERY
Download sequence
Identical sequences jgi|Zasce1|66787|fgenesh1_pm.19_#_131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]