SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|68424|fgenesh1_pm.30_#_49 from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|68424|fgenesh1_pm.30_#_49
Domain Number 1 Region: 115-474
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 7.06e-84
Family Glutamine synthetase catalytic domain 0.0000724
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00000183
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|68424|fgenesh1_pm.30_#_49
Sequence length 476
Sequence
MQTTITSEDAAEVLKNDNRIMVAGVDGDGILRGKVMAKDKFLANVPSGFGMSSALFGWDM
HDILYDDGDKICPKDQGYADFIAVPDLESFRRLPWQDDMPFFMLRFESHGQSLQVDGRGM
IQSLQDKLMEAGCQAKAGVELEFMNFQVPRADGYHEGSIGSELAAFLKTQSPDALRPLTE
GMFGYSVSRPGLNSGYFYNIFDQAERFQCPVEGWHTESGPGVFEAALKVADITDIADRVT
LFKFLARSVGAQHGIAPCFMAKPKGGLPGNSGHIHISLVDKDDKNLFTRDLPDKDAEWED
ITHVSDTGRHFLAGILNALPDIMPLLAPTINSYKRLVENYWAPTNVSWGLEDRMSSVRLI
APPTCKPSATRLEIRVPGADLHPHYALTALLSAGWSGVRNKTPISIPPSSARTDKPELLP
NDLESALRNFTRTDSVPRELLGDEFVDYYTRSRRHELRMWREAVTDWEFKRYIETV
Download sequence
Identical sequences jgi|Zasce1|68424|fgenesh1_pm.30_#_49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]