SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|26911|gm1.11273_g from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|26911|gm1.11273_g
Domain Number 1 Region: 456-817
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.06e-67
Family PFOR PP module 0.0000339
Further Details:      
 
Domain Number 2 Region: 1085-1289
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.54e-55
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000234
Further Details:      
 
Domain Number 3 Region: 783-939
Classification Level Classification E-value
Superfamily Flavoproteins 3.75e-38
Family Cytochrome p450 reductase N-terminal domain-like 0.014
Further Details:      
 
Domain Number 4 Region: 1374-1503
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.22e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000143
Further Details:      
 
Domain Number 5 Region: 950-1084
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.34e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0016
Further Details:      
 
Domain Number 6 Region: 1291-1369
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.65e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.00064
Further Details:      
 
Domain Number 7 Region: 302-442
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.73e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0023
Further Details:      
 
Domain Number 8 Region: 6-208
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000765
Family PFOR Pyr module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|26911|gm1.11273_g
Sequence length 1525
Sequence
MASITTAGEAVARIAYLSSDAVVSVQPSLAADSEFSKHLKQYAAKEASSIVCRQTPEIYS
VRHNADPLLDVYSRVRNGKITTVTTGSGVLVKSIPHLYRLAQYPVVIHVSLHPSGFPDYG
DITSIRNTGFTFLQSNSLQEAQDLALTAHALAIRSGRGVIHFFDAANSQQDSPIPHESRQ
WVSSVIPMDVARQYQATKSDESNIYVSEGLAPQRASGIEIGGNTEQLAPSGAASGLASPR
DASSASSSSSDRKNSSSGASEAESATTIESQPKPVSSEDVDTTCTAIWAQIKAQTGRQYS
AFHYTGPANAENALFLFGSDPGLFSAEFDAATPADFFSRVGLITPVLYRPWLTERLIAAV
PRSVKRIAVLEQIKRKTTKWGPILLDLLMSLKSNAEGGAAPLIVGYQLGYIEYTTITQAL
SGIFQNLTSKSPIQNLEIGAHNGPQASQKELELKQPALENAYMKILDHLFGQRLYIANAL
KAQNAGIGDTVRASPEFGFGSLLARKEHRKRFIAEVEAAAKTRDFTTDTPQKWLSQWALV
AEENDKANKLAPEVVSRLSNDGSPAASKLLSAKGLFYKESQWLIGSDAWSYDLGNSGVHH
VLASGENVNLLIIDSTPYSERAAADAARRKKDIGLYAMNFGNAYVASTAVYSSYTQVLQA
MLEAEQFEGPSVVLAYLPYDKESDSPLKALQETKKAVDLGYWPLYRWDPKAEEKNEENFK
LDSERIKEELKAFLARDNKLTQLMRRHPQFHANLSESYGSEVRKVQKRKAKGAYEALLEG
LQGAPMTVLFASDNGNAENLAKRLANRGKARGLKTLSMAMDDYPVEDLASEENVIFISST
AGQGEFPQNGRNMWEAVKNSTDLDLAGVNYSVFALGDSHYWPRKEDKHYYNKPGKDLFAR
LATLGGKSIVDCGLGDDQDPDGYQTGYQEWEPKLWDALGVGNIEGLPEEPPPMTNEDIKI
QSNFLRGTIQEGLDDPSTGAISAADQQLTKFHGTYMQDDRDLRDERKAQGLEPAYSFMIR
CRLPGGVSTPKQWIQMDDISTSLGNETMKLTTRQTFQFHGVVKAKLKPAMQAINRALMTT
IAACGDVNRNVMCSSLPEMSSLHAQAQESAQKISDHLLPSTTAYHEIWLKGMDGEKDVQV
AGDAVQDFEPLYGPTYLPRKFKITIAVPPHNDTDVYAHDIGLIAIRDKGDLAGFNLLAGG
GMGSTHNMKKTYPQIGRMFGYVDKSQVHIACEKIMLVQRDNGDRKNRKHARLKYTIDDMG
VDVFKGQVEELWGQKFQEPKPFKFDSNIDTFGWLKDERGMNHFTMFIENGRIEDTADFPM
KTGLREIAKVHKGEFRLTGNQHLILSNVADADLDDMKAMLKKYKLDNTNFSALRLSSSAC
VAFPTCGLAMAESERYLPELITKLEGAIEENGLRQDSIVMRMTGCPNGCARPWLAEVAFV
GKAFGAYNMYLGGGYHGNRLNKLFRSSIKEDEILSIMKPLLKRYALERNEGERFGDFVIR
IGTIVETKEGRDFHDNTAEVEDDDE
Download sequence
Identical sequences jgi|Zasce1|26911|gm1.11273_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]