SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Zasce1|28821|gm1.13183_g from Zasmidium cellare ATCC 36951 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Zasce1|28821|gm1.13183_g
Domain Number 1 Region: 88-163
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.58e-31
Family Skp1 dimerisation domain-like 0.0000283
Further Details:      
 
Domain Number 2 Region: 8-72
Classification Level Classification E-value
Superfamily POZ domain 2.54e-20
Family BTB/POZ domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Zasce1|28821|gm1.13183_g
Sequence length 166
Sequence
MASEAEQTVKLVSSDNVEIVTERKVAERSMLIKNMIEDLGAPGEEPIPIMNVSEAVLRKV
LEWCTHHKNDPAPSQDDDADSRKKTTDIEDWDQKFMQVDQEMLFEIILAANYMDIKALLD
VGCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEDR
Download sequence
Identical sequences jgi|Zasce1|28821|gm1.13183_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]