SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa003221m|PACid:17652359 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa003221m|PACid:17652359
Domain Number 1 Region: 268-376
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-16
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 51-191
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000863
Family BTB/POZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa003221m|PACid:17652359
Sequence length 591
Sequence
MANYSAEPSSSLTFTSSSHIPNASKTHNNPSSSSGCEPVPSLEVISLTKLSSNLEQLLLV
DSSSDYSDAVIIVEGKSVGVYRCILASRSSFFGELFKRANGSSEKEGKPTYCMSDLLPYG
NVLYEAFLVFLSYVYTGKLKPFPMEVSTCVHSVCAHDACGPAINFAVELMYASSVFQMPD
LVSILQRRLINFVGKALADDVIPILLVGFHCKLSQLIDQCIERVARSDLDSISLEKELPD
EIVEKIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDE
ANALHYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARV
SELTLDGESAVSICRRLTRAKDYHSKTERGEEANKDRICIDVLEREMQRNPMAADASISS
QIMPDDLHMQLLNLENRVAFARLLFPTEAKVAMAIAHAETTSQFSGLSSFKGSTGNLMDV
DLNETPTVQNKRLRSRLEALMKTVSTGRSYFPHCSEVLDKFIKDDLPDLFFLETGTPDEQ
KIKRTRFMELKEEVQKAFSKDKAAKNLFRLSSSSSSSSLKNVGENLKVGKL
Download sequence
Identical sequences M5WMT1
XP_007213800.1.23749 ppa003221m|PACid:17652359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]