SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa004513m|PACid:17643648 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa004513m|PACid:17643648
Domain Number 1 Region: 155-243
Classification Level Classification E-value
Superfamily BSD domain-like 6.02e-19
Family BSD domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ppa004513m|PACid:17643648
Domain Number - Region: 18-62
Classification Level Classification E-value
Superfamily TSP9-like 0.0876
Family TSP9-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ppa004513m|PACid:17643648
Sequence length 505
Sequence
MNFFKSVFSDEPDPPNPDSESESEPESRKNPEQEDADSKSPPSQPDPNPSSNSGGWMFGD
LIKTLATKSESVIETYRRDLQEFGSGLKKEIEVAQGSLETVGSVIDEFGNTVLKGTAQII
SQGTDAILAPDHVSDSSDPNSQSFSSQQGLNSKRYSRFDVQVRAIQGDAGTYCEEPEDLD
EFNKWKSGFVLEDKSEEIEGLFEENGAMESIYKRVVPSSVDHETFWCRYFYRVYKLRQAE
DVRANLVKRAISIEEDEELSWDVDDEEYDESVSNVVSKANSAKNTEGAASGKVEKVEDLK
VDSEVGDKSSSNVGEVSSVGEEANVWSKKGDLAANRELVSKDSEQMNVKEESSSVEESQV
AGTSSSVVDEKGGKSPEMDKEKKDSAVKLSGDKETEKKVIVEGDSGKKDLPSKSEEKVAL
EGKNEALESGDASVVSNRSSAPEEEDLGWDEIEDLSGIDEKKVTHVGSGSSNKADLRKRL
STAEEEEEEDLSWDIEDEDDEPAKP
Download sequence
Identical sequences M5VI72
ppa004513m|PACid:17643648 XP_007199615.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]