SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa008422m|PACid:17655438 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa008422m|PACid:17655438
Domain Number 1 Region: 101-218
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.71e-17
Family N-utilization substance G protein NusG, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 277-327
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000011
Family N-utilization substance G protein NusG, C-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa008422m|PACid:17655438
Sequence length 332
Sequence
MTQGLLQWSPCHQSLSLSFTIPTTKHTQLPLSISATLEPATSTQQHLTARERRQLRNERR
ESKAGTNWKEQVEEKLLEKPTKKFANWKEELNINNLAREGPQWWIVKVSRLKGQETAQLI
ARLLARNYPHIDFKVYAPAIHERKKLKNGTYSVKPKPLFPGCVFIRCVLDKEIHDFIREC
DGVGGFVGALVGNTKRQITRPRPVSEFDMEAIFRQAKEEQQKAEQAFEQDQQEAALNSGL
NSDDAVKSTGDSKPKRRSRKTLDPLINGSSKGKNEKLVPGSSVRVVSGTFAEYVGSLKKL
NRRTKKATVGFTLFGKESLVDLDVSEIVSETM
Download sequence
Identical sequences M5VZ30
ppa008422m|PACid:17655438 XP_007205518.1.23749 XP_020422847.1.23749 XP_020422848.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]