SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa013971m|PACid:17657001 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa013971m|PACid:17657001
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily TSP9-like 1.07e-21
Family TSP9-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa013971m|PACid:17657001
Sequence length 93
Sequence
MASLTMVFAPVPTGRASSRVYAATAAKGGSKEEKGLLDWILGGLAKEDQLLETDPILKKV
EDKNGATNGGRKGTVEIPQKKKGGFGGLFVKKD
Download sequence
Identical sequences M5WDM9
XP_007206189.1.23749 ppa013971m|PACid:17657001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]