SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ppa018872m|PACid:17651097 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa018872m|PACid:17651097
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000165
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 72-132
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000000209
Family Skp1 dimerisation domain-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa018872m|PACid:17651097
Sequence length 139
Sequence
MSSSKSRVFRLRCLNDEIIEVNEAAAVLCETIKNMVEEGCEGDEISVPNVTAEILGKVME
WCNKHAKGKETKEELKEWDAEFLNVDLYHIFIAADYPYNKELVALVSQKVADMIRGKKID
EIREVFKLKNDMPPELVKE
Download sequence
Identical sequences M5WQ39
ppa018872m|PACid:17651097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]