SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa022555m|PACid:17658146 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ppa022555m|PACid:17658146
Domain Number - Region: 13-78
Classification Level Classification E-value
Superfamily TSP9-like 0.0392
Family TSP9-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa022555m|PACid:17658146
Sequence length 124
Sequence
MIHAIRSLRTQSPSNLVQKASGVRFRQNATISTDPDTKHNMDKTQNPNQQKTGDAMSHSF
GEGYATRSDEEGFGGVFSGNQSLPKTQQDQLIHENHPAYDKTQGSEVKEKEKGRHQTQAN
ASTN
Download sequence
Identical sequences M5WF00
ppa022555m|PACid:17658146 XP_007204141.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]