SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa023298m|PACid:17656925 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa023298m|PACid:17656925
Domain Number 1 Region: 406-573
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.88e-37
Family BRCA2 helical domain 0.0011
Further Details:      
 
Domain Number 2 Region: 574-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.4e-37
Family Single strand DNA-binding domain, SSB 0.00015
Further Details:      
 
Domain Number 3 Region: 702-731,849-934
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.08e-23
Family Single strand DNA-binding domain, SSB 0.0091
Further Details:      
 
Domain Number 4 Region: 732-849
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.35e-19
Family BRCA2 tower domain 0.0024
Further Details:      
 
Domain Number 5 Region: 939-1067
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000024
Family Single strand DNA-binding domain, SSB 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ppa023298m|PACid:17656925
Sequence length 1099
Sequence
MSTWQMFADAGNNYRWYPDTPNGAVYPTPTTTTTTTLHSDSERQQQLKSSSRLPSMADLL
LQGCSKLAEAQTQNQRNGFDADDGVGMFRNGFGRPVAIKPSSLAKASSLLQTGTGQVQAT
NSRGGFSNSLFQTGSGKMVNISPDGLVRAKTLLGLGDDNDHSKLPGSNSGGVAMDAASIS
RSPLINKTVSVQTRCKKNEADLNFMSPERLNLTPDKPSSIKFHTAGGRSISVSTDALQRA
RSLLGDPELGSFLNEGDAGDSVFSFSKGRGHDERTPFSHQKMTRKNFLTKTSVSPLQSSS
KQVRSSSAINSSTNLITQFDVVSNESVCKSNSELPYRQEKPLSDKPCIIKTVENNYLENG
GSLRINPVGKSLAKPLVDISNTVGTTAMNSTQKSGVKRRLGRSSISPFKKPRTSNSSTPL
HKNVPLVRNGLSTLSSDHLCSKRRVSTRYPFSVTRMYVKKYFGMPPPDQNMFECLSDPGR
RITASNAEKYMFLDESGLNCIGAEAFVHMLARSGALMQYTSREWVTNHYKWVVWKLACYE
RCHLAKSFGNFLTVSNVLEELKYRYEREVNHGHRSAIKRILEGDASPSSMVVLCISAIRS
NCDPNMETSSRAENSGAAKVELTDGWYSVDAVLDALLSKQLASGKLFVGQKLRIWGAALC
GWAGPVSPLEVARTVTFRLHINGTYRAHWADRLGFCKGAGAPLAFNCVKSGGGAVPCTLL
GVTRIYPVLYKERLSNGRSVVRSERLESQMVQSYQERRSNVIEGIISEFQRGLEHSHLCN
DSDSEGAKLLKILETATEPEILMAEMSSEQLKSFTKYRSKLEAIKQSDMEKSILKALEDA
GLSEREVTPFMRVRVVGLTRKLCHGKDSSKEGLITIWNPSEKQKTELVEGRAYRVSGLIP
TSSDVGTLHLLVRGSTTTWQPLSQQAVEHFKPFFNPRKSVLLSDLGKVPLSSEFDIAAFV
VFVGEVYIAAHQKKQWVFVTDGSISELNSEESCDSLLAVCFCSPYTGVDSIAPINYNLTG
STVGFCNLTKREKDQMNSLWVAEATETSAYFLSFDTPHCSHLKDAAVSTERWGRISSLIV
LDLDFDLRCTKLSWVLRDK
Download sequence
Identical sequences M5WY76
ppa023298m|PACid:17656925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]