SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ppa023922m|PACid:17667929 from Prunus persica v139

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ppa023922m|PACid:17667929
Domain Number 1 Region: 125-156
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000388
Family Rho termination factor, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ppa023922m|PACid:17667929
Sequence length 160
Sequence
ASDQEEIISLFRRIQTSISNKESVNAKKINSNVSEDSPSSESILQALYGSRKQKGKALDK
AGQEVWTRRKDTQEQQIQEDPSVAEFKLTRPPSKFVKRSPIPSQSIPRGQVLELNNGASS
SAAGRIEEMKLPELKELAKTRGIKGYSKLKKSELVQLLKS
Download sequence
Identical sequences M5WLJ9
ppa023922m|PACid:17667929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]